Ottawa Valley Railway References Navigation menuwww.gwrr.com/operations/railroads/north_america/ottawa_valley_railwayeee"Ottawa Valley Railway""Ottawa Valley Railway - RLK""Genesee & Wyoming to pay $1.39B for RailAmerica""UPDATE 4-Genesee & Wyoming to buy RailAmerica for $1.4 billion"Decision, Case No. 42772"RailAmerica inks new deal to operate Ottawa Valley Railway""OTTAWA VALLEY RAILWAY (RLK)""Workers begin salvaging Canadian Pacific's Ottawa Valley line""Death knell for Ottawa Valley rail line. - The Millstone"eeee

APRBCRYBNSFBTRCBNSCMQCEMRCFLCNCPCSXTCTRWEMRYETLFLRGEXRGFRGSRGWRSHBRYHCRYIRRSKRCKFRKPRLMRMNRYMDWNBSRNSOBRYONTOSOVRPARQGRYQNSLQRCRCRRRLHHRSSCRSLQSORASRYSSSSVITRRTRTRRYVIAWHRCvteAMTCMQCSXTGOTHBRYKLRKRCNSONTQNSXRMVTSHWCEWPYACBCOLCDACC&KC&PRCARCAR (original)CASOCCRCERCGRCNoRCVCW&LERDARE&NARGTPRGTRH&SWHBRICR/IRCK&PMECMCMRMMANRNTRNYCNS&TNARN&PJNRCNSROA&PSO&QRRPCPEIRPSCRSLQT&NRTTVRANRAPRAPREARNDARMBRRBCRYBFDCBLRCCBNSCEMRCFCCFLSFGCFOCFQGCFRSCRCRMCTRWCWRLENRETRFSSR/EKRCGEXRGHRPGFRGJDPARGWWDGWRHCRRHCRYHCWRHPHVIRRSKFRKHRKPRKVSRLWRL&PSMNRYNBSROKANOBRYOSROVROVOPDCRPCHRPOMPSTRQGRYRLHHRLKRMRSS&HRSCRSLQSORSRCLSRYSSRSSSSTCRSTERSVITRRYVAEXVDHRWABLWLRSWSJR/WCRWCRAWHRCWLRCYDHRANYB&HERBCERBQBW&NWBRCBCCFMGC&KC&SLCVRCVRCW&LERDHDVRDWPEIRG&LSGFCRGRNRGVRH&BIRH&DRH&NWRHERHG&BERHGRHIRHREHSRH&SWIRMK&PK&SKLRKVRL&LERL&MSRLENLB&PRMVRRM&MR/M&MMKNRMSRTNBECN&NRN&NWRN&SNN&RWNGRNSRNSRNYRO&QOCRROLOO&RRR/ORRRPAD&WR/PADWQCQSRS&LSARSOOSTLHSW&ARTIT&MERT&SERTG&BTCRTHBTNRTRCTS&MJRTSt.RTSRT&YRRWIWARWCRWE&LSRWESRWG&BWTV&IRAMTCMQCSXTGOTHBRYKLRKRCNSONTQNSXRMVTSHWCEWPYANRAPRAPREARNDARMBRRBCRYBFDCBLRCCBNSCEMRCFCCFLSFGCFOCFQGCFRSCRCRMCTRWCWRLENRETRFSSR/EKRCGEXRGHRPGFRGJDPARGWWDGWRHCRRHCRYHCWRHPHVIRRSKFRKHRKPRKVSRLWRL&PSMNRYNBSROKANOBRYOSROVROVOPDCRPCHRPOMPSTRQGRYRLHHRLKRMRSS&HRSCRSLQSORSRCLSRYSSRSSSSTCRSTERSVITRRYVAEXVDHRWABLWLRSWSJR/WCRWCRAWHRCWLRCYDHRAlabama & Gulf CoastAliquippa & Ohio RiverAN RailwayArizona & CaliforniaArizona EasternArkansas, Louisiana & MississippiArkansas MidlandAtlantic & WesternBauxite & NorthernBay LineBuffalo & PittsburghAllegheny & EasternPittsburg & ShawmutCalifornia NorthernCape Breton & Central Nova ScotiaCarolina PiedmontCascade & Columbia RiverCentral Oregon & PacificCentral of IndianaCentral of IndianapolisCGChattahoochee BayChattahoochee IndustrialChattooga & ChickamaugaChesapeake & AlbemarleChicago, Fort Wayne & EasternColumbus & ChattahoocheeColumbus & GreenvilleColumbus & Ohio RiverCommonwealthConecuh ValleyConnecticut SouthernCorpus Christi TerminalDallas, Garland & NortheasternEast TennesseeEastern AlabamaFirst CoastFordyce & PrincetonGalvestonGeorgia CentralGeorgia SouthwesternGoderich–ExeterGolden Isles TerminalGrand Rapids EasternHeart of GeorgiaHuron & EasternHuron CentralIllinois & MidlandIndiana & OhioIndiana SouthernKiamichiKnob Lake & TimminsKyleLittle Rock & WesternLouisiana & DeltaLuxapalila ValleyMahoning ValleyMarquetteMaryland MidlandMassena TerminalMeridian & BigbeeMichigan ShoreMid-MichiganMissouri & Northern ArkansasNew England CentralNorth Carolina & VirginiaOhio CentralOhio SouthernOlympia and BelmoreOttawa ValleyOtter Tail ValleyPittsburgh & Ohio CentralPoint Comfort & NorthernPortland & WesternPrescott & NorthwesternProvidence & WorcesterPuget Sound & PacificQuebec GatineauRapid City, Pierre & EasternRiceboro SouthernRochester & SouthernDansville & Mount MorrisGenesee & WyomingRockdale, Sandow & SouthernSt. Lawrence & Atlantic / St-Laurent & AtlantiqueSan Diego & Imperial ValleySan Joaquin ValleySavannah Port TerminalSouth BuffaloSouth Carolina CentralSouthern OntarioTalleyrand TerminalTazewell & PeoriaTexas NortheasternThree NotchToledo, Peoria & WesternTomahawkUtahSalt Lake City SouthernValdostaVentura CountyWarren & Saline RiverWarren & TrumbullWellsboro & CorningWestern KentuckyWestern LabradorWillamette & PacificWilmington TerminalWiregrass CentralYorkYoungstown & AustintownYoungstown Belt


Ontario railwaysRailAmericaCompanies operating former Canadian Pacific Railway linesRailway companies established in 1996


reporting markCanadianrailwayOntarioQuebecGenesee & Wyoming Inc.Canadian Pacific RailwaySudbury, OntarioSmiths Falls, OntarioGenesee & Wyoming Inc.$Surface Transportation BoardTemiscaming, QuebecTorontoPetawawa, OntarioMattawaRenfrewPembroke, OntarioCanadian National RailwayNorth Bay, OntarioOntario Northland RailroadHuron Central Railwayintermodal





















Ottawa Valley Railway
Ottawa Valley Railway

RLK #3029 entering the CP Sudbury yard
RLK #3029 entering the CP Sudbury yard

Reporting markRLK
Locale
Ontario, Quebec, Canada
Dates of operation1996 (1996)–Present
PredecessorCanadian Pacific Railway
Track gauge
4 ft 8 1⁄2 in (1,435 mm) standard gauge
Length150 miles (240 km)
HeadquartersNorth Bay, Ontario
Websitewww.gwrr.com/operations/railroads/north_america/ottawa_valley_railway


[
  • v

  • t

  • e

]

Ottawa Valley Railway
Cartier Subdivision

Legend
































































CPR Cartier Subdivision













70.47

Jct CN Bala Subdivision (256.8)












69.2

Jct Falconbridge Spur (0.0)











69.1

Coniston












Wanapitei











62.7
Stinson











55.1
Markstay












Hagar











42.0

Warren











33.9
Verner











26.5
Cache Bay











23.4

Sturgeon Falls











17.0
Collings











10.5

Beaucage











1.0
Clanachan











0.0
Huard













OVR North Bay Subdivision



[
  • v

  • t

  • e

]

Ottawa Valley Railway
North Bay Subdivision

Legend



























































































OVR Cartier Subdivision











117.3
Huard











116.9

North Bay











115.2
Mile 115.2














CN Newmarket Sub












111.9

ETI Canada spur











111.4

Thorncliff











104.9
Camey











97.4

Bonfield











90.7
Rutherglen












89.3

Columbia Forest Products spur











84.0
Eau Claire











76.9

Morel












71.8

Mattawa OVR Temiscaming Subdivision











70.0

end of steel











65.0

Rankin











56.0

Hodgson











50.3

Deux Rivieres











45.6

Aylen











35.8

Adelard











27.7

Stonecliffe











20.3

Mackey











15.0

Moor Lake











5.3

Wylie











0.0

Chalk River













Chalk River Subdivision



[
  • v

  • t

  • e

]

Ottawa Valley Railway
Temiscaming Subdivision

Legend






































40.5

Temiscaming











39.4
Grimmer











38.7
Gordon Creek











32.9
Beauchene











21.0
Crest











12.0
Snake Creek











6.7
Ceramic













Ottawa River













0.0

Mattawa OVR North Bay Subdivision

Ottawa Valley Railway (reporting mark RLK) is a Canadian railway that operates 150 miles (240 km) of track in the provinces of Ontario and Quebec, and is owned by Genesee & Wyoming Canada Inc., the Canadian subsidiary of Genesee & Wyoming Inc.[1]


The railroad began operations on 30 October 1996 under the auspices of RaiLink Canada, and fell under the control of RailAmerica after that company bought RaiLink in July 1999.[2][3] It was formed to operate both local trains and through-service Canadian Pacific Railway trains between Sudbury, Ontario and Smiths Falls, Ontario.[3] On July 23, 2012, Genesee & Wyoming Inc. announced that it intended to purchase RailAmerica in a deal valued at $1.39 billion.[4][5] Approval of the purchase was granted by the U.S. Surface Transportation Board on December 19, 2012.[6]


Currently, the OVR operates between Sudbury and Temiscaming, Quebec,[7] reduced from its original routing between Sudbury and Smiths Falls with a branch to Temiscaming.[8]


The rerouting came about as a result of the reduction of both local traffic on the line and through traffic operated by the Canadian Pacific. As traffic was reduced on other CP routes, that railway was able to redirect trains onto its lines through Toronto, and RailAmerica's lease on the line to the east of Petawawa, Ontario ended in December 2009.[3] The OVR continued operating the route between Sudbury and Temiscaming, and in early October 2010, RailAmerica and CP reached a new agreement under which those operations would continue, while CP would continue procedures for ending service to the east of Mattawa.[7] On 3 August 2011, it was announced that the rails between Renfrew and Pembroke, Ontario were planned to be removed by the end of the year, with the remainder of the Mattawa—Smiths Falls route to be removed in following years.[9]


The OVR interchanges with the Canadian Pacific at Sudbury, as well as with the Canadian National Railway at North Bay, Ontario, the Ontario Northland Railroad at North Bay, and the Huron Central Railway at Sudbury.[2]


The railway once hauled around 70,000 carloads a year, the majority of which came from CP's intermodal bridge traffic. The rest of it was self-generated, and included chemicals and forest products.[8] Very little of this traffic came from east of Mattawa.[10] As of 2013, carloadings amount to approximately 8,000 per year. [1]



References





  1. ^ ab "Ottawa Valley Railway". Genesee & Wyoming Canada Inc. 2014-02-19. Retrieved 2014-03-03..mw-parser-output cite.citationfont-style:inherit.mw-parser-output .citation qquotes:"""""""'""'".mw-parser-output .citation .cs1-lock-free abackground:url("//upload.wikimedia.org/wikipedia/commons/thumb/6/65/Lock-green.svg/9px-Lock-green.svg.png")no-repeat;background-position:right .1em center.mw-parser-output .citation .cs1-lock-limited a,.mw-parser-output .citation .cs1-lock-registration abackground:url("//upload.wikimedia.org/wikipedia/commons/thumb/d/d6/Lock-gray-alt-2.svg/9px-Lock-gray-alt-2.svg.png")no-repeat;background-position:right .1em center.mw-parser-output .citation .cs1-lock-subscription abackground:url("//upload.wikimedia.org/wikipedia/commons/thumb/a/aa/Lock-red-alt-2.svg/9px-Lock-red-alt-2.svg.png")no-repeat;background-position:right .1em center.mw-parser-output .cs1-subscription,.mw-parser-output .cs1-registrationcolor:#555.mw-parser-output .cs1-subscription span,.mw-parser-output .cs1-registration spanborder-bottom:1px dotted;cursor:help.mw-parser-output .cs1-ws-icon abackground:url("//upload.wikimedia.org/wikipedia/commons/thumb/4/4c/Wikisource-logo.svg/12px-Wikisource-logo.svg.png")no-repeat;background-position:right .1em center.mw-parser-output code.cs1-codecolor:inherit;background:inherit;border:inherit;padding:inherit.mw-parser-output .cs1-hidden-errordisplay:none;font-size:100%.mw-parser-output .cs1-visible-errorfont-size:100%.mw-parser-output .cs1-maintdisplay:none;color:#33aa33;margin-left:0.3em.mw-parser-output .cs1-subscription,.mw-parser-output .cs1-registration,.mw-parser-output .cs1-formatfont-size:95%.mw-parser-output .cs1-kern-left,.mw-parser-output .cs1-kern-wl-leftpadding-left:0.2em.mw-parser-output .cs1-kern-right,.mw-parser-output .cs1-kern-wl-rightpadding-right:0.2em


  2. ^ ab "Ottawa Valley Railway - RLK". Canadian Pacific Railway. Retrieved 8 October 2010.


  3. ^ abc Cummings, Andy (March 2010). "Short line falls to recession". Trains Magazine. Kalmbach Publishing.


  4. ^ Associated Press (July 23, 2012). "Genesee & Wyoming to pay $1.39B for RailAmerica". STL Today.com. Retrieved July 23, 2012.
    [permanent dead link]


  5. ^ "UPDATE 4-Genesee & Wyoming to buy RailAmerica for $1.4 billion". Reuters. July 23, 2012. Retrieved July 23, 2012.


  6. ^ Surface Transportation Board, Decision, Case No. 42772, December 19, 2012


  7. ^ ab "RailAmerica inks new deal to operate Ottawa Valley Railway". Trains Magazine. 4 October 2010. Retrieved 8 October 2010.


  8. ^ ab "OTTAWA VALLEY RAILWAY (RLK)". RailAmerica. Retrieved 8 October 2010.


  9. ^ "Workers begin salvaging Canadian Pacific's Ottawa Valley line". Trains Magazine. 3 August 2011. Retrieved 7 August 2011.


  10. ^ "Death knell for Ottawa Valley rail line. - The Millstone". www.millstonenews.com. Retrieved 23 April 2018.











Companies operating former Canadian Pacific Railway lines, Ontario railways, RailAmerica, Railway companies established in 1996Uncategorized
-

Popular posts from this blog

Word for a person who has no opinion about whether god existsWord for having a definite opinion while simultaneously withholding judgment?What's the opposite of “newcomer? Is ”veteran" OK?What do you call an “atheist” who might believe in an afterlife?What's a word for someone who wants to voice opinions but not have them challenged?Word for someone who dismisses contrary opinions as irrational?Somone who thinks they are overly special/out of the ordinaryIs there a word, phrase or idiom for “a person who is incapable of thinking about the future”?The belief that a god is human-likeA word for a non-famous person/thing you have heard a lot aboutAdjective for a person who enjoys taking care of their appearance

Image
Reverse string, can I make it faster? How strictly should I take "Candidates must be local"? Are there historical instances of the capital of a colonising country being temporarily or permanently shifted to one of its colonies? Accepted offer letter, position changed Could you please stop shuffling the deck and play already? How to secure an aircraft at a transient parking space? At what distance can a bugbear, holding a reach weapon, with the Polearm Master feat, get their Opportunity Attack? Why was Goose renamed from Chewie for the Captain Marvel film? Is it necessary to separate DC power cables and data cables? Is "history" a male-biased word ("his+story")? Why the color red for the Republican Party What's wrong with this bogus proof? Doesn't allowing a user mode program to access kernel space memory and execute the IN and OUT instructions defeat the purpose of having CPU modes? Can one live in the U.S. and not use a c...
Read more

What was this official D&D 3.5e Lovecraft-flavored rulebook?What was this set of RPG tools called?As a first-time DM should I let my players play complex character classes and roles?Nymph's Kiss and the RelationshipWhat was the name of this Cleric Prestige Class that shapes metal with its bare hands?Are the 3.5e Dragonlance books third party or official works?What's up with the domain Vile Darkness?What was this 80s book about RPGs?What was the name of this Werewolf band?What book had Rituals to “upgrade” animal companions to keep them viable at higher levels?What was this RPG that had rules for player-owned businesses?

Image
Can a Bard use an arcane focus? Indicating multiple different modes of speech (fantasy language or telepathy) The most efficient algorithm to find all possible integer pairs which sum to a given integer A known event to a history junkie How to color a zone in Tikz Simple image editor tool to draw a simple box/rectangle in an existing image Golf game boilerplate Can I use my Chinese passport to enter China after I acquired another citizenship? No idea how to draw this using tikz Is there an Impartial Brexit Deal comparison site? Reply ‘no position’ while the job posting is still there (‘HiWi’ position in Germany) Bob has never been a M before Lifted its hind leg on or lifted its hind leg towards? Can I rely on these GitHub repository files? How do I repair my stair bannister? Pronouncing Homer as in modern Greek What do you call the infoboxes with text and sometimes images on the side of a page we find in textbooks? What will be t...
Read more

2017 IndyCar Series Contents Series news Teams and drivers Schedule Season summary Footnotes References External links Navigation menu"INDYCAR: Initial 2018 bodywork concepts unveiled"the original"IndyCar confirms switch to Performance Friction brakes in 2017""AJ Foyt Racing will switch to Chevy"the original"Carlos Munoz, Conor Daly will drive for AJ Foyt Racing""Zach Veach's Indy 500 Debut Confirmed with Foyt""No mass exodus from Honda after Ganassi switch""Ex-F1 driver Sato joins Andretti Autosport for 2017 IndyCar season""IndyCar's Ryan Hunter-Reay, sponsor DHL paired through 2020""hhgregg and Andretti Autosport announce partnership for key races in 2016""INDYCAR: Rossi re-signs with Andretti"the original"McLaren Formula 1 - Fernando Alonso to race at Indy 500 with McLaren, Honda and Andretti Autosport""Shank will finally take part in Indy 500 with Harvey, Andretti | MotorSportsTalk""Andretti adds Jack Harvey to Indy 500 field""Ganassi switches to Honda power for 2017""INDYCAR: Chilton returns to Ganassi"the original"IndyCar silly season: Who's going where in 2017?""INDYCAR: Kanaan, NTT Data return to Ganassi"the original"Kimball to remain at Ganassi for 2017""Coyne confirms Bourdais for 2017 IndyCar season""Davison to sub for Bourdais in Indy 500"the original"Gutierrez confirmed for Detroit IndyCar debut""Gutierrez returns with Coyne for rest of 2017 season""Vautier to drive for Coyne at Texas"the original"INDYCAR: Coyne confirms Jones for 2017"the original"Pippa Mann returns to Coyne for Indy 500""Karam, Dreyer & Reinbold teaming up again for Indianapolis 500""Pigot to return to Ed Carpenter Racing""Hildebrand confirmed as full-time Ed Carpenter driver""Veach to replace injured Hildebrand at Barber"the originalNew Team Harding Racing Enters Chaves for 101st Indianapolis 500"Juncos Racing Announces Entry in 101st Running of the Indianapolis 500 :: Juncos Racing""Juncos confirms Pigot for Indy 500""Saavedra confirmed in Juncos' second 500 entry"the original"Lazier confirms Indy 500 run after son's USF2000 debut"the original"Claman DeMelo to race for RLLR at Sonoma"the original"Rahal signs Servia and ace engineer for 2017""IndyCar: Aleshin returns with Schmidt"the original"Aleshin replaced by Saavedra for Toronto""Jack Harvey will pilot SPM No. 7 car at Watkins Glen, Sonoma""Jay Howard confirmed in Tony Stewart's supported SPM Indy entry""INDYCAR: Newgarden to wave the flag at Penske"the original"Pagenaud opts for No. 1 in 2017"the original"Penske confirms Newgarden for 2017""Montoya to stay with Team Penske in 2017""Target leaving IndyCar after 27 seasons with Chip Ganassi""Cavin: IndyCar could see complete driver/team shakeup in 2017""End of the road for KV Racing?""KV Racing confirms closure, equipment sold to Juncos""Juncos confirms IndyCar Series entry"the original"Juncos readies IndyCar program, aims for '17 500"the original"Harding Racing to add Texas, Pocono to schedule"the original"Sato signs with Andretti Autosport for 2017""INDYCAR: Aleshin in Doubt at SPM"the original"Long Beach notebook: JR Hildebrand breaks hand""Hildebrand cleared to return at Phoenix"the original"Bourdais to undergo surgery on multiple fractures""Aleshin loses Schmidt Peterson IndyCar ride""Saavedra in at SPM for Pocono, Gateway"the original"Bourdais to make return at Gateway"the original"The IndyCar Grand Prix no longer is sponsored by Angie's List""2017 IndyCar Series rulebook""2017 Verizon IndyCar Series Official Rulebook"Official websiteeeeee

Image
1905190919101911191219131914191519161917191819191920192119221923192419251926192719281929193019311932193319341935193619371938193919401941194619471948194919501951195219531954195519791980198119821983198419851986198719881989199019911992199319941995199619971998199920002001200220032004200520062007200819961996–971998199920002001200220032004200520062007200820092010201120122013201420152016201720182019Kenny BräckBuzz CalkinsScott DixonDario FranchittiSam Hornish Jr.Ryan Hunter-ReayTony KanaanBuddy LazierJosef NewgardenSimon PagenaudWill PowerGreg RayScott SharpTony StewartDan WheldonGatewayIndianapolisIowaPoconoTexasBarberCircuit of the AmericasIndianapolisLaguna SecaMid-OhioPortlandRoad AmericaDetroitLong BeachSt. PetersburgTorontoAtlantaBaltimoreCharlotteChicagolandDoverEdmontonFontanaHomesteadHoustonKansasKentuckyLas VegasLouisianaMichiganMilwaukeeMotegiNashvilleNazarethNew HampshirePhoenixPikes PeakRichmondSão PauloSonomaSurfers ParadiseWalt Disney WorldWatkins GlenBostonBras...
Read more